Lineage for d5yvdb1 (5yvd B:1-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894871Species Middle east respiratory syndrome-related coronavirus [TaxId:1335626] [356572] (1 PDB entry)
  8. 2894873Domain d5yvdb1: 5yvd B:1-187 [356573]
    Other proteins in same PDB: d5yvda2, d5yvdb2
    automated match to d2rhba1
    complexed with gol

Details for d5yvdb1

PDB Entry: 5yvd (more details), 2.7 Å

PDB Description: structural and biochemical characterization of endoribonuclease nsp15 encoded by middle east respiratory syndrome coronavirus
PDB Compounds: (B:) Nsp15

SCOPe Domain Sequences for d5yvdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yvdb1 c.66.1.0 (B:1-187) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]}
gleniafnvvkqghfigvegelpvavvndkiftksgvndicmfenkttlptniafelyak
ravrshpdfkllhnlqadicykfvlwdyersniygtatigvckytdidvnsalnicfdir
dncslekfmstpnaifisdrkikkypcmvgpdyayfngaiirdsdvvkqpvkfylykkvn
nefidpt

SCOPe Domain Coordinates for d5yvdb1:

Click to download the PDB-style file with coordinates for d5yvdb1.
(The format of our PDB-style files is described here.)

Timeline for d5yvdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yvdb2