Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Middle east respiratory syndrome-related coronavirus [TaxId:1335626] [356572] (1 PDB entry) |
Domain d5yvdb1: 5yvd B:1-187 [356573] Other proteins in same PDB: d5yvda2, d5yvdb2 automated match to d2rhba1 complexed with gol |
PDB Entry: 5yvd (more details), 2.7 Å
SCOPe Domain Sequences for d5yvdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yvdb1 c.66.1.0 (B:1-187) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]} gleniafnvvkqghfigvegelpvavvndkiftksgvndicmfenkttlptniafelyak ravrshpdfkllhnlqadicykfvlwdyersniygtatigvckytdidvnsalnicfdir dncslekfmstpnaifisdrkikkypcmvgpdyayfngaiirdsdvvkqpvkfylykkvn nefidpt
Timeline for d5yvdb1: