SCOPe 2.06: Domain d1rpja_: 1rpj A:

Lineage for d1rpja_ (1rpj A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein D-allose-binding protein [53828] (1 species)

7. Species Escherichia coli [TaxId:562] [53829] (3 PDB entries)

8. Domain d1rpja_: 1rpj A: [35656]
   complexed with all, so4, zn

Details for d1rpja_

PDB Entry: 1rpj, 1.8 Å

PDB Description: crystal structure of d-allose binding protein from escherichia coli

PDB Compounds: (A:) protein (precursor of periplasmic sugar receptor)

SCOPe Domain Sequences for d1rpja_:

Sequence; same for both SEQRES and ATOM records:

>d1rpja_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]}
aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq

Timeline for d1rpja_:

• d1rpja_ first appeared (with stable ids) in SCOP 1.55
  
• d1rpja_ appears in SCOPe 2.05
  
• d1rpja_ appears in SCOPe 2.07
  
• d1rpja_ appears in the current release, SCOPe 2.08