Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Petrotoga mobilis [TaxId:403833] [356460] (1 PDB entry) |
Domain d6h9sb1: 6h9s B:1-140 [356550] Other proteins in same PDB: d6h9sa2, d6h9sb2 automated match to d1hyha1 complexed with nad |
PDB Entry: 6h9s (more details), 1.9 Å
SCOPe Domain Sequences for d6h9sb1:
Sequence, based on SEQRES records: (download)
>d6h9sb1 c.2.1.0 (B:1-140) automated matches {Petrotoga mobilis [TaxId: 403833]} mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag eysdiegsdivlitagaaqkpgetrldltiknakiikgisenikkyapntliinitnpvd vmsyvvwkvtgfesnrvigt
>d6h9sb1 c.2.1.0 (B:1-140) automated matches {Petrotoga mobilis [TaxId: 403833]} mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag eysdiegsdivlitagaaetrldltiknakiikgisenikkyapntliinitnpvdvmsy vvwkvtgfesnrvigt
Timeline for d6h9sb1: