Lineage for d9abpa_ (9abp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913044Protein L-arabinose-binding protein [53826] (1 species)
  7. 2913045Species Escherichia coli [TaxId:562] [53827] (9 PDB entries)
  8. 2913054Domain d9abpa_: 9abp A: [35655]
    complexed with gal, gla; mutant

Details for d9abpa_

PDB Entry: 9abp (more details), 1.97 Å

PDB Description: a pro to gly mutation in the hinge of the arabinose-binding protein enhances binding and alters specificity: sugar-binding and crystallographic studies
PDB Compounds: (A:) l-arabinose-binding protein

SCOPe Domain Sequences for d9abpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d9abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllgspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk

SCOPe Domain Coordinates for d9abpa_:

Click to download the PDB-style file with coordinates for d9abpa_.
(The format of our PDB-style files is described here.)

Timeline for d9abpa_: