SCOPe 2.08: Domain d9abpa_: 9abp A:

Lineage for d9abpa_ (9abp A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein L-arabinose-binding protein [53826] (1 species)

7. Species Escherichia coli [TaxId:562] [53827] (9 PDB entries)

8. Domain d9abpa_: 9abp A: [35655]
   complexed with gal, gla; mutant

Details for d9abpa_

PDB Entry: 9abp, 1.97 Å

PDB Description: a pro to gly mutation in the hinge of the arabinose-binding protein enhances binding and alters specificity: sugar-binding and crystallographic studies

PDB Compounds: (A:) l-arabinose-binding protein

SCOPe Domain Sequences for d9abpa_:

Sequence; same for both SEQRES and ATOM records:

>d9abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllgspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk

Timeline for d9abpa_:

• d9abpa_ first appeared (with stable ids) in SCOP 1.55, called d9abp__
  
• d9abpa_ appears in SCOPe 2.07