Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d6gmqe1: 6gmq E:17-111 [356516] Other proteins in same PDB: d6gmqa_, d6gmqb2, d6gmqc_, d6gmqd_, d6gmqe2, d6gmqf_, d6gmqg_, d6gmqi_, d6gmqj_, d6gmqk2, d6gmql_ automated match to d1lm8c_ complexed with act, f4k, ipa |
PDB Entry: 6gmq (more details), 2.76 Å
SCOPe Domain Sequences for d6gmqe1:
Sequence, based on SEQRES records: (download)
>d6gmqe1 d.42.1.1 (E:17-111) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfld
>d6gmqe1 d.42.1.1 (E:17-111) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn ssteipefpiapeialellmaanfld
Timeline for d6gmqe1: