![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries) |
![]() | Domain d6gwsb1: 6gws B:1-126 [356509] automated match to d1plqa1 protein/DNA complex |
PDB Entry: 6gws (more details), 2.9 Å
SCOPe Domain Sequences for d6gwsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gwsb1 d.131.1.0 (B:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd ldveql
Timeline for d6gwsb1:
![]() Domains from other chains: (mouse over for more information) d6gwsa1, d6gwsa2, d6gwsc1, d6gwsc2 |