SCOPe 2.07: Domain d7abpa_: 7abp A:

Lineage for d7abpa_ (7abp A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein L-arabinose-binding protein [53826] (1 species)

7. Species Escherichia coli [TaxId:562] [53827] (9 PDB entries)

8. Domain d7abpa_: 7abp A: [35649]
   mutant

Details for d7abpa_

PDB Entry: 7abp, 1.67 Å

PDB Description: sugar-binding and crystallographic studies of an arabinose-binding protein mutant (met108leu) which exhibits enhanced affinity and altered specificity

PDB Compounds: (A:) l-arabinose-binding protein

SCOPe Domain Sequences for d7abpa_:

Sequence; same for both SEQRES and ATOM records:

>d7abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmlaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk

Timeline for d7abpa_:

• d7abpa_ first appeared (with stable ids) in SCOP 1.55, called d7abp__
  
• d7abpa_ appears in SCOPe 2.06
  
• d7abpa_ appears in the current release, SCOPe 2.08