Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
Protein automated matches [191142] (6 species) not a true protein |
Species Nomascus leucogenys [TaxId:61853] [335245] (17 PDB entries) |
Domain d6esna1: 6esn A:265-507 [356469] Other proteins in same PDB: d6esna2, d6esna3 automated match to d5x8ua_ complexed with bwe, na |
PDB Entry: 6esn (more details), 1.84 Å
SCOPe Domain Sequences for d6esna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6esna1 a.123.1.0 (A:265-507) automated matches {Nomascus leucogenys [TaxId: 61853]} aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke lfs
Timeline for d6esna1: