Lineage for d6h6qb_ (6h6q B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589070Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2589071Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2589072Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2589206Protein automated matches [190700] (1 species)
    not a true protein
  7. 2589207Species Human (Homo sapiens) [TaxId:9606] [187840] (46 PDB entries)
  8. 3056402Domain d6h6qb_: 6h6q B: [356464]
    automated match to d2opza_
    complexed with fuk, zn

Details for d6h6qb_

PDB Entry: 6h6q (more details), 2.63 Å

PDB Description: fragment derived xiap inhibitor
PDB Compounds: (B:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d6h6qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h6qb_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggl
tdwkpsedpweqhakwypgckylleqkgqeyinnihlthslee

SCOPe Domain Coordinates for d6h6qb_:

Click to download the PDB-style file with coordinates for d6h6qb_.
(The format of our PDB-style files is described here.)

Timeline for d6h6qb_: