Lineage for d1urpd_ (1urp D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75160Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 75161Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 75162Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 75172Protein D-ribose-binding protein [53824] (1 species)
  7. 75173Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries)
  8. 75183Domain d1urpd_: 1urp D: [35646]

Details for d1urpd_

PDB Entry: 1urp (more details), 2.3 Å

PDB Description: d-ribose-binding protein from escherichia coli

SCOP Domain Sequences for d1urpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urpd_ c.93.1.1 (D:) D-ribose-binding protein {Escherichia coli, strain k-12}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq

SCOP Domain Coordinates for d1urpd_:

Click to download the PDB-style file with coordinates for d1urpd_.
(The format of our PDB-style files is described here.)

Timeline for d1urpd_: