![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein D-ribose-binding protein [53824] (1 species) |
![]() | Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries) |
![]() | Domain d1urpd_: 1urp D: [35646] |
PDB Entry: 1urp (more details), 2.3 Å
SCOPe Domain Sequences for d1urpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urpd_ c.93.1.1 (D:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi gakgvetadkvlkgekvqakypvdlklvvkq
Timeline for d1urpd_: