SCOPe 2.08: Domain d6gwsa2: 6gws A:127-255

Lineage for d6gwsa2 (6gws A:127-255)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries)

8. Domain d6gwsa2: 6gws A:127-255 [356458]
   automated match to d1plqa2
   protein/DNA complex

Details for d6gwsa2

PDB Entry: 6gws, 2.9 Å

PDB Description: crystal structure of human pcna in complex with three p15 peptides

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6gwsa2:

Sequence; same for both SEQRES and ATOM records:

>d6gwsa2 d.131.1.0 (A:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Timeline for d6gwsa2:

• d6gwsa2 first appeared in SCOPe 2.07