Lineage for d6gwsa1 (6gws A:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977364Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries)
  8. 2977393Domain d6gwsa1: 6gws A:1-126 [356457]
    automated match to d1plqa1
    protein/DNA complex

Details for d6gwsa1

PDB Entry: 6gws (more details), 2.9 Å

PDB Description: crystal structure of human pcna in complex with three p15 peptides
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6gwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwsa1 d.131.1.0 (A:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d6gwsa1:

Click to download the PDB-style file with coordinates for d6gwsa1.
(The format of our PDB-style files is described here.)

Timeline for d6gwsa1: