Lineage for d6gvda2 (6gvd A:178-525)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440921Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
    Pfam PF01055
  6. 2440970Protein automated matches [310869] (3 species)
    not a true protein
  7. 2440984Species Thermotoga maritima [TaxId:243274] [356451] (5 PDB entries)
  8. 2440985Domain d6gvda2: 6gvd A:178-525 [356455]
    Other proteins in same PDB: d6gvda1, d6gvda3
    automated match to d1zy9a2
    complexed with fdk, mg, so4

Details for d6gvda2

PDB Entry: 6gvd (more details), 1.22 Å

PDB Description: alpha-galactosidase from thermotoga maritima in complex with cyclohexene-based carbasugar mimic of galactose
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d6gvda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gvda2 c.1.8.13 (A:178-525) automated matches {Thermotoga maritima [TaxId: 243274]}
rvpkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdigdwlvtrgdf
psveemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmayrnwnkkiya
ldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqafrkgietirk
avgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrnaitryfm
hdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgkkvlket
lellggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhleke

SCOPe Domain Coordinates for d6gvda2:

Click to download the PDB-style file with coordinates for d6gvda2.
(The format of our PDB-style files is described here.)

Timeline for d6gvda2: