Lineage for d1urpc_ (1urp C:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) 
Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins) 
Protein D-ribose-binding protein [53824] (1 species) Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries) 
Domain d1urpc_: 1urp C: [35645]
Details for d1urpc_
PDB Entry: 1urp (more details), 2.3 Å
PDB Description: d-ribose-binding protein from escherichia coli
SCOP Domain Sequences for d1urpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urpc_ c.93.1.1 (C:) D-ribose-binding protein {Escherichia coli, strain k-12}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq
SCOP Domain Coordinates for d1urpc_:
Click to download the PDB-style file with coordinates for d1urpc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1urpc_:
- d1urpc_ appears in SCOP 1.57
- d1urpc_ appears in the current release, SCOPe 2.08
View in 3D
