Lineage for d1urpb_ (1urp B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845996Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 845997Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 845998Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins)
  6. 846015Protein D-ribose-binding protein [53824] (1 species)
  7. 846016Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries)
  8. 846024Domain d1urpb_: 1urp B: [35644]

Details for d1urpb_

PDB Entry: 1urp (more details), 2.3 Å

PDB Description: d-ribose-binding protein from escherichia coli
PDB Compounds: (B:) d-ribose-binding protein

SCOP Domain Sequences for d1urpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urpb_ c.93.1.1 (B:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq

SCOP Domain Coordinates for d1urpb_:

Click to download the PDB-style file with coordinates for d1urpb_.
(The format of our PDB-style files is described here.)

Timeline for d1urpb_: