Lineage for d6g5ta1 (6g5t A:0-153)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301126Protein Myoglobin [46469] (10 species)
  7. 2301271Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (301 PDB entries)
    Uniprot P02185
  8. 3056368Domain d6g5ta1: 6g5t A:0-153 [356430]
    Other proteins in same PDB: d6g5ta2
    automated match to d2mgja_
    complexed with edo, hem

Details for d6g5ta1

PDB Entry: 6g5t (more details), 1.5 Å

PDB Description: myoglobin h64v/v68a in the resting state, 1.5 angstrom resolution
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d6g5ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g5ta1 a.1.1.2 (A:0-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d6g5ta1:

Click to download the PDB-style file with coordinates for d6g5ta1.
(The format of our PDB-style files is described here.)

Timeline for d6g5ta1:

  • d6g5ta1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-23

View in 3D
Domains from same chain:
(mouse over for more information)
d6g5ta2