Lineage for d1urpa_ (1urp A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28022Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 28023Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 28024Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 28034Protein D-ribose-binding protein [53824] (1 species)
  7. 28035Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries)
  8. 28042Domain d1urpa_: 1urp A: [35643]

Details for d1urpa_

PDB Entry: 1urp (more details), 2.3 Å

PDB Description: d-ribose-binding protein from escherichia coli

SCOP Domain Sequences for d1urpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urpa_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq

SCOP Domain Coordinates for d1urpa_:

Click to download the PDB-style file with coordinates for d1urpa_.
(The format of our PDB-style files is described here.)

Timeline for d1urpa_: