Lineage for d6g5ba1 (6g5b A:1001-1153)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688020Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
    Uniprot P02185
  8. 2688233Domain d6g5ba1: 6g5b A:1001-1153 [356418]
    Other proteins in same PDB: d6g5ba2
    automated match to d2mgja_
    complexed with eee, hem

Details for d6g5ba1

PDB Entry: 6g5b (more details), 1.6 Å

PDB Description: heme-carbene complex in myoglobin h64v/v68a containing an n- methylhistidine as the proximal ligand, 1.6 angstrom resolution
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d6g5ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g5ba1 a.1.1.2 (A:1001-1153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d6g5ba1:

Click to download the PDB-style file with coordinates for d6g5ba1.
(The format of our PDB-style files is described here.)

Timeline for d6g5ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6g5ba2