Lineage for d6a4ua_ (6a4u A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317508Species Marsupenaeus japonicus [TaxId:27405] [356321] (1 PDB entry)
  8. 2317509Domain d6a4ua_: 6a4u A: [356408]
    automated match to d3a9qe_
    complexed with cl, edo, mg, so4

Details for d6a4ua_

PDB Entry: 6a4u (more details), 1.16 Å

PDB Description: the first crystal structure of crustacean ferritin that is a hybrid type of h and l ferritin
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d6a4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a4ua_ a.25.1.0 (A:) automated matches {Marsupenaeus japonicus [TaxId: 27405]}
asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln

SCOPe Domain Coordinates for d6a4ua_:

Click to download the PDB-style file with coordinates for d6a4ua_.
(The format of our PDB-style files is described here.)

Timeline for d6a4ua_: