![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (16 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
![]() | Domain d6drvb4: 6drv B:627-731 [356404] Other proteins in same PDB: d6drva1, d6drva3, d6drva5, d6drvb1, d6drvb3, d6drvb5, d6drvc1, d6drvc3, d6drvc5 automated match to d1jz8a2 |
PDB Entry: 6drv (more details), 2.2 Å
SCOPe Domain Sequences for d6drvb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6drvb4 b.1.4.0 (B:627-731) automated matches {Escherichia coli [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d6drvb4:
![]() Domains from same chain: (mouse over for more information) d6drvb1, d6drvb2, d6drvb3, d6drvb5 |