Lineage for d6drvb1 (6drv B:1-220)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384843Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries)
  8. 2384853Domain d6drvb1: 6drv B:1-220 [356401]
    Other proteins in same PDB: d6drva2, d6drva3, d6drva4, d6drva5, d6drvb2, d6drvb3, d6drvb4, d6drvb5, d6drvc2, d6drvc3, d6drvc4, d6drvc5
    automated match to d1f4ha3

Details for d6drvb1

PDB Entry: 6drv (more details), 2.2 Å

PDB Description: beta-galactosidase
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6drvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6drvb1 b.18.1.0 (B:1-220) automated matches {Escherichia coli [TaxId: 83333]}
mtmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewr
fawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenp
tgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflra
genrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d6drvb1:

Click to download the PDB-style file with coordinates for d6drvb1.
(The format of our PDB-style files is described here.)

Timeline for d6drvb1: