Lineage for d1ba2a_ (1ba2 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321700Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 321701Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 321702Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)
  6. 321715Protein D-ribose-binding protein [53824] (1 species)
  7. 321716Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries)
  8. 321720Domain d1ba2a_: 1ba2 A: [35640]

Details for d1ba2a_

PDB Entry: 1ba2 (more details), 2.1 Å

PDB Description: d67r mutant of d-ribose-binding protein from escherichia coli

SCOP Domain Sequences for d1ba2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ba2a_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptrsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq

SCOP Domain Coordinates for d1ba2a_:

Click to download the PDB-style file with coordinates for d1ba2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ba2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ba2b_