Lineage for d6fyja_ (6fyj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2723142Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2723143Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2724019Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2724020Protein automated matches [190847] (99 species)
    not a true protein
  7. 2724106Species Bacillus methanolicus [TaxId:1471] [356398] (1 PDB entry)
  8. 2724107Domain d6fyja_: 6fyj A: [356399]
    automated match to d5m0oa_
    complexed with hem, myr, peg

Details for d6fyja_

PDB Entry: 6fyj (more details), 1.3 Å

PDB Description: cytochrome p450 peroxygenase cyp152k6 in complex with myristic acid
PDB Compounds: (A:) Fatty-acid peroxygenase

SCOPe Domain Sequences for d6fyja_:

Sequence, based on SEQRES records: (download)

>d6fyja_ a.104.1.0 (A:) automated matches {Bacillus methanolicus [TaxId: 1471]}
sninqmpreegidstwrlmeegymyilnrrhsfnsdifetrllgkkaicmggkeaaeify
dtekfkrkdaapnrvvqtlfgkngvqaldgqthkhrkemfmsimspdelekltditkkqw
eiavdkweqmdkvilyeeakeimcrtacqwagvpvqenevkrltknlgamfesaaavglk
hwlgrharnyeeiwieelidrvrdgkvnppenttlhkfswyrdlegnlldtetaavevin
ilrpivaiaifinfialalhhypeekeklksgdkkysqmfvqevrrfypffpfvvalvkk
dftwkgykfeegtltlldlygtnhdpeiwknpdvfspdrfakwegspfsfipqgggdyfm
ghrcagewvtievmkvsldyltnrmdyevpdqdlsfsmasmpsiphskvviknvkkri

Sequence, based on observed residues (ATOM records): (download)

>d6fyja_ a.104.1.0 (A:) automated matches {Bacillus methanolicus [TaxId: 1471]}
sninqmpreegidstwrlmeegymyilnrrhsfnsdifetrllgkkaicmggkeaaeify
dtekfkrkdaapnrvvqtlfgkngvqaldgqthkhrkemfmsimspdelekltditkkqw
eiavdkweqmdkvilyeeakeimcrtacqwagvpvqenevkrltknlgamfesaaavglk
hwlgrharnyeeiwieelidrvrdgkvnppenttlhkfswyrdlegnlldtetaavevin
ilrpivaiaifinfialalhhypeekeklksgdkkysqmfvqevrrfypffpfvvalvkk
dftwkgykfeegtltlldlygtnhdpeiwknpdvfspdrfakwgspfsfipqgggdyfmg
hrcagewvtievmkvsldyltnrmdyevpdqdlsfsmasmpsiphskvviknvkkri

SCOPe Domain Coordinates for d6fyja_:

Click to download the PDB-style file with coordinates for d6fyja_.
(The format of our PDB-style files is described here.)

Timeline for d6fyja_: