Lineage for d1dbp__ (1dbp -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) 
Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins) 
Protein D-ribose-binding protein [53824] (1 species) Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries) 
Domain d1dbp__: 1dbp - [35639]
Details for d1dbp__
PDB Entry: 1dbp (more details), 2.2 Å
PDB Description: identical mutations at corresponding positions in two homologous proteins with non-identical effects
SCOP Domain Sequences for d1dbp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dbp__ c.93.1.1 (-) D-ribose-binding protein {Escherichia coli, strain k-12}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptdsdavdnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq
SCOP Domain Coordinates for d1dbp__:
Click to download the PDB-style file with coordinates for d1dbp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dbp__:
- d1dbp__ appears in SCOP 1.57
- d1dbp__ appears in the current release, SCOPe 2.08, called d1dbpa_
View in 3D