Lineage for d6cluc_ (6clu C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425526Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2425527Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 2425632Protein automated matches [194480] (7 species)
    not a true protein
  7. 3056274Species Staphylococcus aureus [TaxId:1280] [356336] (2 PDB entries)
  8. 3056327Domain d6cluc_: 6clu C: [356389]
    automated match to d1ad1b_
    mutant

Details for d6cluc_

PDB Entry: 6clu (more details), 1.95 Å

PDB Description: staphylococcus aureus dihydropteroate synthase (sadhps) f17l e208k double mutant structure
PDB Compounds: (C:) dihydropteroate synthase

SCOPe Domain Sequences for d6cluc_:

Sequence, based on SEQRES records: (download)

>d6cluc_ c.1.21.1 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tktkimgilnvtpdslsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve
eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky
daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae
vmarldelvateypvllatsrkrftkkmmgydttpverdevtaattaygimkgvravrvh
nvelnaklakgidflkenena

Sequence, based on observed residues (ATOM records): (download)

>d6cluc_ c.1.21.1 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tktkimgilnvnvesavtrvkammdegadiidvgitveeelnrvlpvveaivgfdvkisv
dtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivlmhngepvveemltsll
aqahqakiagipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkk
mmtpverdevtaattaygimkgvravrvhnvelnaklakgidflkenena

SCOPe Domain Coordinates for d6cluc_:

Click to download the PDB-style file with coordinates for d6cluc_.
(The format of our PDB-style files is described here.)

Timeline for d6cluc_:

  • d6cluc_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-23