Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) |
Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
Protein automated matches [194480] (7 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [356336] (2 PDB entries) |
Domain d6cluc_: 6clu C: [356389] automated match to d1ad1b_ mutant |
PDB Entry: 6clu (more details), 1.95 Å
SCOPe Domain Sequences for d6cluc_:
Sequence, based on SEQRES records: (download)
>d6cluc_ c.1.21.1 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]} tktkimgilnvtpdslsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae vmarldelvateypvllatsrkrftkkmmgydttpverdevtaattaygimkgvravrvh nvelnaklakgidflkenena
>d6cluc_ c.1.21.1 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]} tktkimgilnvnvesavtrvkammdegadiidvgitveeelnrvlpvveaivgfdvkisv dtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivlmhngepvveemltsll aqahqakiagipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkk mmtpverdevtaattaygimkgvravrvhnvelnaklakgidflkenena
Timeline for d6cluc_: