SCOPe 2.07: Domain d6e49b2: 6e49 B:127-255

Lineage for d6e49b2 (6e49 B:127-255)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries)

8. Domain d6e49b2: 6e49 B:127-255 [356382]
   automated match to d1plqa2
   protein/DNA complex

Details for d6e49b2

PDB Entry: 6e49, 2.9 Å

PDB Description: pif1 peptide bound to pcna trimer

PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6e49b2:

Sequence; same for both SEQRES and ATOM records:

>d6e49b2 d.131.1.2 (B:127-255) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfn

Timeline for d6e49b2:

• d6e49b2 is new in SCOPe 2.07-stable
  
• d6e49b2 appears in the current release, SCOPe 2.08