Lineage for d1drka_ (1drk A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. Protein D-ribose-binding protein [53824] (1 species)
  7. Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries)
  8. Domain d1drka_: 1drk A: [35638]
    complexed with rip

Details for d1drka_

PDB Entry: 1drk (more details), 2 Å

PDB Description: probing protein-protein interactions: the ribose-binding protein in bacterial transport and chemotaxis
PDB Compounds: (A:) d-ribose-binding protein

SCOPe Domain Sequences for d1drka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drka_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgtaatsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq

SCOPe Domain Coordinates for d1drka_ are not available.

Timeline for d1drka_: