Lineage for d6cs8a2 (6cs8 A:285-495)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477146Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2477447Protein automated matches [190304] (16 species)
    not a true protein
  7. 2477471Species Escherichia coli [TaxId:83333] [356353] (9 PDB entries)
  8. 2477484Domain d6cs8a2: 6cs8 A:285-495 [356360]
    Other proteins in same PDB: d6cs8a1, d6cs8a3, d6cs8b1, d6cs8b3
    automated match to d2qy9a2
    complexed with f9y, na

Details for d6cs8a2

PDB Entry: 6cs8 (more details), 1.75 Å

PDB Description: high resolution crystal structure of ftsy-ng domain of e. coli
PDB Compounds: (A:) signal recognition particle receptor ftsy

SCOPe Domain Sequences for d6cs8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cs8a2 c.37.1.10 (A:285-495) automated matches {Escherichia coli [TaxId: 83333]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfar

SCOPe Domain Coordinates for d6cs8a2:

Click to download the PDB-style file with coordinates for d6cs8a2.
(The format of our PDB-style files is described here.)

Timeline for d6cs8a2: