Lineage for d6aa7b_ (6aa7 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2509060Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2509061Protein automated matches [190526] (25 species)
    not a true protein
  7. 3056262Species Acropora digitifera [TaxId:70779] [356323] (1 PDB entry)
  8. 3056296Domain d6aa7b_: 6aa7 B: [356358]
    automated match to d2ojka_

Details for d6aa7b_

PDB Entry: 6aa7 (more details), 1.8 Å

PDB Description: fluorescent protein from acropora digitifera
PDB Compounds: (B:) fluorescent protein

SCOPe Domain Sequences for d6aa7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aa7b_ d.22.1.0 (B:) automated matches {Acropora digitifera [TaxId: 70779]}
khgltkdmtmkyrmegcvdghkfvitghgngspfegkqtinlcvveggplpfsedilsav
fdygnrvftdypqgmvdffknscpagytwqrsllfedgavctasaditvsveencfyhes
kfhgvnfpadgpvmkkmtinwepccekiipvprqgilkgdvamylllkdggryrcqfdtv
ykaktdskkmpewhfiqhkltredrsdaknqkwqlaehsvasrsala

SCOPe Domain Coordinates for d6aa7b_:

Click to download the PDB-style file with coordinates for d6aa7b_.
(The format of our PDB-style files is described here.)

Timeline for d6aa7b_:

  • d6aa7b_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d6aa7a_