Lineage for d1qh8c_ (1qh8 C:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 250478Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 250499Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 250520Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the interchain arrangment of domains 1 is similar to the intrachain arrangement of domains 2 and 3
  6. 250521Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 250551Species Klebsiella pneumoniae [TaxId:573] [81400] (4 PDB entries)
  8. 250557Domain d1qh8c_: 1qh8 C: [35635]
    Other proteins in same PDB: d1qh8b_, d1qh8d_

Details for d1qh8c_

PDB Entry: 1qh8 (more details), 1.6 Å

PDB Description: nitrogenase mofe protein from klebsiella pneumoniae, as-crystallized (mixed oxidation) state

SCOP Domain Sequences for d1qh8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh8c_ c.92.2.3 (C:) Nitrogenase iron-molybdenum protein, alpha chain {Klebsiella pneumoniae}
tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl

SCOP Domain Coordinates for d1qh8c_:

Click to download the PDB-style file with coordinates for d1qh8c_.
(The format of our PDB-style files is described here.)

Timeline for d1qh8c_: