Lineage for d6bojd_ (6boj D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2349733Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2349797Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2349798Species Human (Homo sapiens) [TaxId:9606] [89152] (72 PDB entries)
    Uniprot Q08499 388-713
  8. 2349875Domain d6bojd_: 6boj D: [356345]
    automated match to d3iada_
    complexed with cl, e31, mg, mpd, zn

Details for d6bojd_

PDB Entry: 6boj (more details), 1.7 Å

PDB Description: crystal structure of the pde4d catalytic domain and ucr2 regulatory helix with bpn5004
PDB Compounds: (D:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d6bojd_:

Sequence, based on SEQRES records: (download)

>d6bojd_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
vhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisntfld

Sequence, based on observed residues (ATOM records): (download)

>d6bojd_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtvllldnysdriqvlqnmvhcadlsnptkplqlyr
qwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvhp
daqdildtlednrewyqstipgnqvsefisntfld

SCOPe Domain Coordinates for d6bojd_:

Click to download the PDB-style file with coordinates for d6bojd_.
(The format of our PDB-style files is described here.)

Timeline for d6bojd_: