Lineage for d6bojb_ (6boj B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [89152] (82 PDB entries)
    Uniprot Q08499 388-713
  8. Domain d6bojb_: 6boj B: [356344]
    automated match to d3iada_
    complexed with cl, e31, mg, mpd, zn

Details for d6bojb_

PDB Entry: 6boj (more details), 1.7000000000000002 Å

PDB Description: crystal structure of the pde4d catalytic domain and ucr2 regulatory helix with bpn5004
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d6bojb_:

Sequence, based on SEQRES records: (download)

>d6bojb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
vhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisntfld

Sequence, based on observed residues (ATOM records): (download)

>d6bojb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtvllldnysdriqvlqnmvhcadlsnptkplqlyr
qwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvhp
daqdildtlednrewyqstipgnqvsefisntfld

SCOPe Domain Coordinates for d6bojb_ are not available.

Timeline for d6bojb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6boja_, d6bojc_, d6bojd_