Lineage for d6arhb_ (6arh B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445004Species Human (Homo sapiens) [TaxId:9606] [189772] (3 PDB entries)
  8. 2445007Domain d6arhb_: 6arh B: [356335]
    automated match to d3s5oa_
    complexed with act

Details for d6arhb_

PDB Entry: 6arh (more details), 1.6 Å

PDB Description: crystal structure of human nal at a resolution of 1.6 angstrom
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d6arhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6arhb_ c.1.10.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kklqglvaatitpmtengeinfsvigqyvdylvkeqgvknifvngttgeglslsvserrq
vaeewvtkgkdkldqviihvgalslkesqelaqhaaeigadgiaviapfflkpwtkdili
nflkevaaaapalpfyyyhipaltgvkiraeelldgildkiptfqglkfsdtdlldfgqc
vdqnrqqqfaflfgvdeqllsalvmgatgavgstynylgkktnqmleafeqkdfslalny
qfciqrfinfvvklgfgvsqtkaimtlvsgipmgpprlplqkasreftdsaeaklksldf
lsf

SCOPe Domain Coordinates for d6arhb_:

Click to download the PDB-style file with coordinates for d6arhb_.
(The format of our PDB-style files is described here.)

Timeline for d6arhb_: