Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein automated matches [190087] (15 species) not a true protein |
Species Escherichia coli [TaxId:83333] [356329] (1 PDB entry) |
Domain d6arib_: 6ari B: [356334] automated match to d1n3bb_ complexed with bqv, cit, edo |
PDB Entry: 6ari (more details), 2 Å
SCOPe Domain Sequences for d6arib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6arib_ c.37.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]} mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd aiasdvarlhahylqlasqfvsq
Timeline for d6arib_: