SCOPe 2.07: Domain d6aria_: 6ari A:

Lineage for d6aria_ (6ari A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [356329] (1 PDB entry)

8. Domain d6aria_: 6ari A: [356330]
   automated match to d1n3bb_
   complexed with bqv, cit, edo

Details for d6aria_

PDB Entry: 6ari, 2 Å

PDB Description: crystal structure of a dephospho-coa kinase from escherichia coli in complex with inhibitor cm078

PDB Compounds: (A:) dephospho-coa kinase

SCOPe Domain Sequences for d6aria_:

Sequence; same for both SEQRES and ATOM records:

>d6aria_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
aiasdvarlhahylqlasqf

Timeline for d6aria_:

• d6aria_ is new in SCOPe 2.07-stable
  
• d6aria_ appears in the current release, SCOPe 2.08