Lineage for d6aria_ (6ari A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866250Species Escherichia coli [TaxId:83333] [356329] (1 PDB entry)
  8. 2866251Domain d6aria_: 6ari A: [356330]
    automated match to d1n3bb_
    complexed with bqv, cit, edo

Details for d6aria_

PDB Entry: 6ari (more details), 2 Å

PDB Description: crystal structure of a dephospho-coa kinase from escherichia coli in complex with inhibitor cm078
PDB Compounds: (A:) dephospho-coa kinase

SCOPe Domain Sequences for d6aria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aria_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
aiasdvarlhahylqlasqf

SCOPe Domain Coordinates for d6aria_:

Click to download the PDB-style file with coordinates for d6aria_.
(The format of our PDB-style files is described here.)

Timeline for d6aria_: