| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
| Protein automated matches [190087] (15 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [356329] (1 PDB entry) |
| Domain d6aria_: 6ari A: [356330] automated match to d1n3bb_ complexed with bqv, cit, edo |
PDB Entry: 6ari (more details), 2 Å
SCOPe Domain Sequences for d6aria_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aria_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
aiasdvarlhahylqlasqf
Timeline for d6aria_: