Lineage for d1qh8a_ (1qh8 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403170Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 403193Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 403222Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  6. 403223Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 403253Species Klebsiella pneumoniae [TaxId:573] [81400] (4 PDB entries)
  8. 403258Domain d1qh8a_: 1qh8 A: [35633]
    Other proteins in same PDB: d1qh8b_, d1qh8d_

Details for d1qh8a_

PDB Entry: 1qh8 (more details), 1.6 Å

PDB Description: nitrogenase mofe protein from klebsiella pneumoniae, as-crystallized (mixed oxidation) state

SCOP Domain Sequences for d1qh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh8a_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Klebsiella pneumoniae}
tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl

SCOP Domain Coordinates for d1qh8a_:

Click to download the PDB-style file with coordinates for d1qh8a_.
(The format of our PDB-style files is described here.)

Timeline for d1qh8a_: