Lineage for d1qh8a_ (1qh8 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75090Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 75106Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 75119Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 75120Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 75147Species Klebsiella pneumoniae [TaxId:573] [53820] (3 PDB entries)
  8. 75156Domain d1qh8a_: 1qh8 A: [35633]

Details for d1qh8a_

PDB Entry: 1qh8 (more details), 1.6 Å

PDB Description: nitrogenase mofe protein from klebsiella pneumoniae, as-crystallized (mixed oxidation) state

SCOP Domain Sequences for d1qh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh8a_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Klebsiella pneumoniae}
tnatgernlaliqevlevfpetarkerrkhmmvsdpkmksvgkciisnrksqpgvmtvrg
cayagskgvvfgpikdmahishgpvgcgqysragrrnyytgvsgvdsfgtlnftsdfqer
divfggdkklsklieemellfpltkgitiqsecpvgligddisavanasskaldkpvipv
rcegfrgvsqslghhiandvvrdwilnnregqpfettpydvaiigdyniggdawasrill
eemglrvvaqwsgdgtlvementpfvklnlvhcyrsmnyiarhmeekhqipwmeynffgp
tkiaeslrkiadqfddtiranaeaviaryegqmaaiiakyrprlegrkvllymgglrprh
vigayedlgmeiiaagyefahnddydrtlpdlkegtllfddassyeleafvkalkpdlig
sgikekyifqkmgvpfrqmhswdysgpyhgydgfaifardmdmtlnnpawneltapwl

SCOP Domain Coordinates for d1qh8a_:

Click to download the PDB-style file with coordinates for d1qh8a_.
(The format of our PDB-style files is described here.)

Timeline for d1qh8a_: