Lineage for d6aq5a_ (6aq5 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. Protein Legume lectin [49904] (23 species)
  7. Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (7 PDB entries)
    Uniprot Q6YD91
  8. Domain d6aq5a_: 6aq5 A: [356328]
    automated match to d1v00c_
    complexed with ca, mn, na, nag

Details for d6aq5a_

PDB Entry: 6aq5 (more details), 2.19 Å

PDB Description: x-ray crystal structure of erythrina crista-galli lectin in complex with epilactose
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d6aq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aq5a_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe

SCOPe Domain Coordinates for d6aq5a_ are not available.

Timeline for d6aq5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6aq5b_