SCOPe 2.07: Domain d6aq6a_: 6aq6 A:

Lineage for d6aq6a_ (6aq6 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (7 PDB entries)
   Uniprot Q6YD91

8. Domain d6aq6a_: 6aq6 A: [356327]
   automated match to d1v00c_
   complexed with act, bma, ca, fuc, gal, man, mn, na, nag, xyp

Details for d6aq6a_

PDB Entry: 6aq6, 1.9 Å

PDB Description: x-ray crystal structure of erythrina crista-galli lectin in complex with n-acetyllactosamine

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d6aq6a_:

Sequence; same for both SEQRES and ATOM records:

>d6aq6a_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe

Timeline for d6aq6a_:

• d6aq6a_ is new in SCOPe 2.07-stable
  
• d6aq6a_ appears in the current release, SCOPe 2.08