Lineage for d6a4ud_ (6a4u D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. Protein automated matches [190036] (58 species)
    not a true protein
  7. Species Kuruma prawn (Marsupenaeus japonicus) [TaxId:27405] [356321] (1 PDB entry)
  8. Domain d6a4ud_: 6a4u D: [356322]
    automated match to d3a9qe_
    complexed with cl, edo, mg, so4

Details for d6a4ud_

PDB Entry: 6a4u (more details), 1.1600000000000001 Å

PDB Description: the first crystal structure of crustacean ferritin that is a hybrid type of h and l ferritin
PDB Compounds: (D:) Ferritin

SCOPe Domain Sequences for d6a4ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a4ud_ a.25.1.0 (D:) automated matches {Kuruma prawn (Marsupenaeus japonicus) [TaxId: 27405]}
asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere
haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn
ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln

SCOPe Domain Coordinates for d6a4ud_ are not available.

Timeline for d6a4ud_:

Domains from other chains:
(mouse over for more information)
d6a4ua_, d6a4ub_, d6a4uc_, d6a4ue_, d6a4uf_