Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Kuruma prawn (Marsupenaeus japonicus) [TaxId:27405] [356321] (5 PDB entries) |
Domain d6a4ud_: 6a4u D: [356322] automated match to d3a9qe_ complexed with cl, edo, mg, so4 |
PDB Entry: 6a4u (more details), 1.16 Å
SCOPe Domain Sequences for d6a4ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a4ud_ a.25.1.0 (D:) automated matches {Kuruma prawn (Marsupenaeus japonicus) [TaxId: 27405]} asqvrqnyhedceasinkqinmelyasyvylsmayyferddvalpgfakffkessdeere haqtfmkyqnkrggrivlqqiaapsmrewgtglealqaaldlekqvnqsllelhstasgn ndphltklledeyleeqvdsikkigdmitklkragptglgeymfdkeln
Timeline for d6a4ud_: