Lineage for d1qh1d_ (1qh1 D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008088Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1008181Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1008223Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  6. 1008267Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 1008309Species Klebsiella pneumoniae [TaxId:573] [81399] (4 PDB entries)
  8. 1008315Domain d1qh1d_: 1qh1 D: [35632]
    Other proteins in same PDB: d1qh1a_, d1qh1c_
    complexed with cfm, cl, clf, edo, hca, mg

Details for d1qh1d_

PDB Entry: 1qh1 (more details), 1.6 Å

PDB Description: nitrogenase mofe protein from klebsiella pneumoniae, phenosafranin oxidized state
PDB Compounds: (D:) protein (nitrogenase molybdenum iron protein)

SCOPe Domain Sequences for d1qh1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh1d_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, beta chain {Klebsiella pneumoniae [TaxId: 573]}
sqtidkinscyplfeqdeyqelfrnkrqleeahdaqrvqevfawtttaeyealnfrreal
tvdpakacqplgavlcslgfantlpyvhgsqgcvayfrtyfnrhfkepiacvsdsmteda
avfggnnnmnlglqnasalykpeiiavsttcmaevigddlqafianakkdgfvdssiavp
hahtpsfigshvtgwdnmfegfaktftadyqgqpgklpklnlvtgfetylgnfrvlkrmm
eqmavpcsllsdpsevldtpadghyrmysggttqqemkeapdaidtlllqpwqllkskkv
vqemwnqpatevaiplglaatdellmtvsqlsgkpiadaltlergrlvdmmldshtwlhg
kkfglygdpdfvmgltrfllelgceptvilshnankrwqkamnkmldaspygrdsevfin
cdlwhfrslmftrqpdfmignsygkfiqrdtlakgkafevplirlgfplfdrhhlhrqtt
wgyegamnivttlvnavlekldsdtsqlgktdysfdlvr

SCOPe Domain Coordinates for d1qh1d_:

Click to download the PDB-style file with coordinates for d1qh1d_.
(The format of our PDB-style files is described here.)

Timeline for d1qh1d_: