Lineage for d1qh1d_ (1qh1 D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127919Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 127935Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 127948Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 127949Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 127976Species Klebsiella pneumoniae [TaxId:573] [53820] (3 PDB entries)
  8. 127984Domain d1qh1d_: 1qh1 D: [35632]

Details for d1qh1d_

PDB Entry: 1qh1 (more details), 1.6 Å

PDB Description: nitrogenase mofe protein from klebsiella pneumoniae, phenosafranin oxidized state
PDB Compounds: (D:)

SCOP Domain Sequences for d1qh1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh1d_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Klebsiella pneumoniae}
sqtidkinscyplfeqdeyqelfrnkrqleeahdaqrvqevfawtttaeyealnfrreal
tvdpakacqplgavlcslgfantlpyvhgsqgcvayfrtyfnrhfkepiacvsdsmteda
avfggnnnmnlglqnasalykpeiiavsttcmaevigddlqafianakkdgfvdssiavp
hahtpsfigshvtgwdnmfegfaktftadyqgqpgklpklnlvtgfetylgnfrvlkrmm
eqmavpcsllsdpsevldtpadghyrmysggttqqemkeapdaidtlllqpwqllkskkv
vqemwnqpatevaiplglaatdellmtvsqlsgkpiadaltlergrlvdmmldshtwlhg
kkfglygdpdfvmgltrfllelgceptvilshnankrwqkamnkmldaspygrdsevfin
cdlwhfrslmftrqpdfmignsygkfiqrdtlakgkafevplirlgfplfdrhhlhrqtt
wgyegamnivttlvnavlekldsdtsqlgktdysfdlvr

SCOP Domain Coordinates for d1qh1d_:

Click to download the PDB-style file with coordinates for d1qh1d_.
(The format of our PDB-style files is described here.)

Timeline for d1qh1d_: