Lineage for d5y6uc_ (5y6u C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2958899Species Bacillus subtilis [TaxId:645657] [356164] (4 PDB entries)
  8. 2958902Domain d5y6uc_: 5y6u C: [356313]
    automated match to d1j7ha_
    complexed with acy

Details for d5y6uc_

PDB Entry: 5y6u (more details), 1.5 Å

PDB Description: crystal structure of wild-type yabj protein from bacillus subtilis (natto).
PDB Compounds: (C:) YabJ protein

SCOPe Domain Sequences for d5y6uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y6uc_ d.79.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 645657]}
tkavhtkhapaaigpysqgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkavl
eeagasfetvvkatvfiadmeqfaevnevygqyfdthkparscvevarlpkdalveievi
alvk

SCOPe Domain Coordinates for d5y6uc_:

Click to download the PDB-style file with coordinates for d5y6uc_.
(The format of our PDB-style files is described here.)

Timeline for d5y6uc_: