SCOPe 2.07: Domain d5yyua1: 5yyu A:1-105

Lineage for d5yyua1 (5yyu A:1-105)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (50 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:681288] [356122] (3 PDB entries)

8. Domain d5yyua1: 5yyu A:1-105 [356311]
   Other proteins in same PDB: d5yyua2
   automated match to d2vw9a_

Details for d5yyua1

PDB Entry: 5yyu, 2.98 Å

PDB Description: crystal structure of staphylococcus aureus single-stranded dna-binding protein ssbb

PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d5yyua1:

Sequence; same for both SEQRES and ATOM records:

>d5yyua1 b.40.4.0 (A:1-105) automated matches {Staphylococcus aureus [TaxId: 681288]}
mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqflep

Timeline for d5yyua1:

• d5yyua1 is new in SCOPe 2.07-stable
  
• d5yyua1 appears in the current release, SCOPe 2.08