![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) ![]() automatically mapped to Pfam PF05392 |
![]() | Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
![]() | Protein automated matches [190272] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187064] (25 PDB entries) |
![]() | Domain d5zcqk_: 5zcq K: [356285] Other proteins in same PDB: d5zcqa_, d5zcqd_, d5zcqe_, d5zcqg_, d5zcqh_, d5zcqi_, d5zcqj_, d5zcql_, d5zcqm_, d5zcqn_, d5zcqq_, d5zcqr_ automated match to d1v54k_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5zcq (more details), 1.65 Å
SCOPe Domain Sequences for d5zcqk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zcqk_ f.23.5.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d5zcqk_: