Lineage for d5z85h_ (5z85 H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327889Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327890Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2327891Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2327946Protein automated matches [190271] (1 species)
    not a true protein
  7. 2327947Species Cow (Bos taurus) [TaxId:9913] [187063] (25 PDB entries)
  8. 2327982Domain d5z85h_: 5z85 H: [356266]
    Other proteins in same PDB: d5z85a_, d5z85b1, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85s_, d5z85t_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_
    automated match to d1v54h_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z85h_

PDB Entry: 5z85 (more details), 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the another batch crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5z85h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z85h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5z85h_:

Click to download the PDB-style file with coordinates for d5z85h_.
(The format of our PDB-style files is described here.)

Timeline for d5z85h_: