![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) ![]() |
![]() | Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
![]() | Protein automated matches [190271] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187063] (25 PDB entries) |
![]() | Domain d5z85h_: 5z85 H: [356266] Other proteins in same PDB: d5z85a_, d5z85b1, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85s_, d5z85t_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_ automated match to d1v54h_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z85 (more details), 1.85 Å
SCOPe Domain Sequences for d5z85h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z85h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d5z85h_: