Lineage for d5zcqh_ (5zcq H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327889Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327890Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2327891Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2327946Protein automated matches [190271] (1 species)
    not a true protein
  7. 2327947Species Cow (Bos taurus) [TaxId:9913] [187063] (25 PDB entries)
  8. 2327966Domain d5zcqh_: 5zcq H: [356263]
    Other proteins in same PDB: d5zcqa_, d5zcqd_, d5zcqe_, d5zcqg_, d5zcqi_, d5zcqj_, d5zcqk_, d5zcql_, d5zcqm_, d5zcqn_, d5zcqq_, d5zcqr_
    automated match to d1v54h_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcqh_

PDB Entry: 5zcq (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 10 mm azide solution for 2 days
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5zcqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcqh_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5zcqh_:

Click to download the PDB-style file with coordinates for d5zcqh_.
(The format of our PDB-style files is described here.)

Timeline for d5zcqh_: