SCOPe 2.07: Domain d5z84o1: 5z84 O:1-90

Lineage for d5z84o1 (5z84 O:1-90)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.0: automated matches [227239] (1 protein)
   not a true family

6. Protein automated matches [226999] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255751] (7 PDB entries)

8. Domain d5z84o1: 5z84 O:1-90 [356259]
   Other proteins in same PDB: d5z84a_, d5z84b2, d5z84c_, d5z84d_, d5z84e_, d5z84f_, d5z84g_, d5z84h_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84m_, d5z84n_, d5z84o2, d5z84p_, d5z84q_, d5z84r_, d5z84s_, d5z84t_, d5z84u_, d5z84v_, d5z84w_, d5z84x_, d5z84y_, d5z84z_
   automated match to d3ag3b1
   complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z84o1

PDB Entry: 5z84, 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the crystals exposed to 20 mm azide solution for 4 days

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5z84o1:

Sequence; same for both SEQRES and ATOM records:

>d5z84o1 f.17.2.0 (O:1-90) automated matches {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d5z84o1:

• d5z84o1 is new in SCOPe 2.07-stable
  
• d5z84o1 appears in the current release, SCOPe 2.08